PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I02017.1.p
Common NameEUGRSUZ_I02017, LOC104420690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 360aa    MW: 40009.1 Da    PI: 6.3409
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I02017.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.71.1e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg WT+eEd +++ +v  +G+g+W++++++ g++R++k+c++rw +yl
  Eucgr.I02017.1.p 14 RGLWTPEEDAKILAYVSTYGTGNWTLVPEKAGLNRCGKSCRLRWTNYL 61
                      788*******************************************97 PP

2Myb_DNA-binding538e-1770110446
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +++eE++l+++++k +G++ W++Ia++++ gRt++++k++w++
  Eucgr.I02017.1.p  70 FSPEEEDLIINLHKIFGSR-WSLIAKHLP-GRTDNDVKNYWNT 110
                       89*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.815965IPR017930Myb domain
SuperFamilySSF466892.11E-3111108IPR009057Homeodomain-like
SMARTSM007173.1E-151363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001675.43E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2565116IPR009057Homeodomain-like
SMARTSM007172.0E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.55566116IPR017930Myb domain
CDDcd001675.69E-1470112No hitNo description
PfamPF002492.7E-1570110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MKRPPCCDKS NVKRGLWTPE EDAKILAYVS TYGTGNWTLV PEKAGLNRCG KSCRLRWTNY  60
LRPDLKHDGF SPEEEDLIIN LHKIFGSRWS LIAKHLPGRT DNDVKNYWNT KLKKKLQKMG  120
IDPLTHKPFS QIFSDFENMS GCPNARHRQI LPAPSCLTQV PAGSNSHLDA IMKPVMEQVH  180
ENFTAENHLS WSQYQVANQD VMQLQPYQCV LSEVTSSCSS SSSPTLTRFN TQQSDGPPLP  240
PPFVAWTGDS ISHQPFPTGN VLPKREGDLQ DIVSSSSINC ASDMAKQALP NTPVGTMACK  300
NEAKWAEPGD SCEGALELDC HFGDGSYSCF GSFTDAILDK DSKMRSELFP EFIDGLLDY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-30141167108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I02017.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030787.10.0PREDICTED: myb-related protein Zm38
TrEMBLA0A059AR010.0A0A059AR01_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-76MYB family protein